PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G01800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 431aa    MW: 45526.7 Da    PI: 5.9571
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G01800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09282339562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l ++
  ONIVA03G01800.1 282 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSAQLTMMQRDSAGLATQ 339
                      999***************************************9999988888777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15278342IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599280343IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.4E-11282333No hitNo description
PfamPF001701.7E-8282340IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-10282339No hitNo description
CDDcd147032.52E-22283334No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MNGGIGDALM QPQHVQVMSS SLPMVASTFV AEPAAAAAAA AANKPRAAGL PPTPPQVFAA  60
QRAAAAAGGD VCMEESAQGG GGGLPPRKAH RRSSSDVPFG YLAGQHQLLP PKVEAGWGHL  120
GAGAGGAAAA DDLFNAYLNL DGLDGLNSSD DRHDEGDSRG SSIKTNGADS SENESEECAD  180
DTRGGIRLWS ADGGERREGV KRNAAGEPAT APLARHARSL SMDSLIGKFN FTAGTAAAAG  240
NGVALGPNRF SLEFGSGEFT PSEMKKIMAD EKLAEMALAD PKRVKRVLAN RQSAARSKER  300
KMRYIAELEQ KVQILQSEAT NLSAQLTMMQ RDSAGLATQN NELKFRLHAM EQQAQLRDAL  360
NEALTTEVQR LKLATAELGD SCSSSSLAQQ IQLNAQNQMF QLQQQQATQI PFYQLQQSQQ  420
NGAAKNNESK E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0GG660.0A0A0E0GG66_ORYNI; Uncharacterized protein
STRINGLOC_Os03g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-79bZIP family protein